Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP002683MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Bgn.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP002683MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Bgn.
DEEASGSDTTSGVPDLDSVTPTFSAMCPFGCHCHLRVVQCSDLGLKTVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHSNNITKVGINDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK Note: The complete sequence may
include tag sequence, target protein sequence, linker sequence
and extra sequence that is translated with the protein sequence
for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant
protein is critical to your application, please explicitly
request the full and complete sequence of this protein before
ordering.
蛋白標簽:
N-terminal 10xHis-tagged
產品提供形式:
Liquid or
Lyophilized powder
Note: We will
preferentially ship the format that we have in stock, however,
if you have any special requirement for the format, please
remark your requirement when placing the order, we will prepare
according to your demand.
緩沖液:
Tris-based buffer,50% glycerol
儲存條件:
Store at -20°C/-80°C upon receipt, aliquoting is
necessary for
mutiple use. Avoid repeated freeze-thaw cycles.
保質期:
The shelf life is related to many factors, storage
state,
buffer ingredients, storage temperature and the stability of the
protein
itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C.
The
shelf life of lyophilized form is 12 months at -20°C/-80°C.
貨期:
3-7 business days
注意事項:
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Knockout results provide evidence that decorin and biglycan are necessary for maintaining collagen fibril structure, fiber realignment, and mechanical properties of mature tendons. PMID: 28882761
A novel biological pathway has been discovered of soluble biglycan inducing HIF-2alpha protein stabilization and Epo production presumably in an oxygen-independent manner, ultimately giving rise to secondary polycythemia. PMID: 27600268
Results show that Bgn plays a role in the process of angiogenesis during fracture healing, and that effect appears to be partially mediated through endostatin suppression. PMID: 27072616
Asporin deficiency changes skin glycosaminoglycan composition, and decorin and biglycan content, which may explain the changes in skin mechanical properties. PMID: 28859141
Biglycan plays a protective role during the progression of atherosclerosis in ApoE-deficient mice by inhibiting thrombin generation. PMID: 27034473
These genes were concordantly induced by TAC in WT but not in biglycan KO mice. CONCLUSIONS: Left ventricular pressure overload induces biglycan expression in cardiac fibroblasts. Ablation of biglycan improves cardiac function and attenuates left ventricular hypertrophy and fibrosis after long-term pressure overload. PMID: 27789290
Importance of biglycan and decorin as targets for the manipulation of fetal membrane extracellular matrix stability in the context of inflammation. PMID: 25914258
Biglycan deficiency leads to loosely packed aortic collagen fibers, increased susceptibility of aortic elastin fibers to angII-induced stress, and up-regulation of vascular perlecan content. PMID: 25093698
Biglycan signaling supported fetal membrane remodeling during early gestation in the absence of concomitant changes in TGFbeta levels. PMID: 24373743
Lumican and biglycan influence corneal keratocyte lamellipodia organization and are critical in the regulation of stromal collagen fibrillogenesis. PMID: 24447998
Biglycan-triggered TLR-2- and TLR-4-signaling exacerbates the pathophysiology of ischemic acute kidney injury. PMID: 24480070
De novo expression of circulating biglycan evokes an innate inflammatory tissue response via MyD88/TRIF pathways. PMID: 24361484
Early stage patellar tendon healing was inferior in biglycan-null and decorin-null mice as compared to wild type. PMID: 24157578
This suggests that biglycan and decorin may have sequential roles in the tendon response to injury. PMID: 24072490
Mast cell chymase degrades the alarmins heat shock protein 70, biglycan, HMGB1, and interleukin-33 (IL-33) and limits danger-induced inflammation. PMID: 24257755
extracellular matrix biglycan mediates breast cancer normalization induced by embryonic mesenchyme PMID: 23817524
Biglycan plays a role in tendon viscoelasticity that cannot be completely explained by its role in collagen fibrillogenesis. PMID: 23592048
Biglycan deletion alters adiponectin expression in murine adipose tissue and 3T3-L1 adipocytes. PMID: 23189205
The glycosaminoglycans chains of biglycan (BGN) promote BGN-assisted BMP-4 function. PMID: 22895561
Bgn inhibits the major properties of HER-2/neu-transformed cells, which is inversely modulated by the PKC signaling cascade. PMID: 22582394
Increased messenger RNA (mRNA) expression of extracellular matrix genes BGN and COL1A1 was observed in the mouse epididymal adipose tissue after high-fat diet. PMID: 21775118
Biglycan/decorin mixed double knockout mouse is a model of dystocia and delayed labor onset. PMID: 22253749
Extracellular matrix protein biglycan plays a novel role in regulating synapse stability. PMID: 22396407
Use of a transplant system and a fracture healing model revealed that expression of Wnt-induced secreted protein 1 was decreased in bone formed by biglycan-deficient cells, further suggesting reduced Wnt signaling in vivo. PMID: 21969569
Biglycan is expressed/developmentally regulated in placenta and fetal membranes; data from mutant mouse strains suggest that both biglycan and decorin contribute to gestational success (i.e., prevent premature birth). PMID: 21502335
critical for temporomandibular joint subchondral bone integrity PMID: 21917603
Biglycan and decorin reduced the proliferation of pre-adipocytes, partly by induction of apoptosis. Furthermore, the anti-proliferative capabilities of decorin and biglycan were nullified with removal of GAG side-chains. PMID: 21702857
bgn deficiency promotes myofibroblast differentiation and proliferation in vitro and in vivo likely due to increased responses to TGF-beta and SMAD2 signaling PMID: 21454527
Biglycan and fibromodulin are novel key players in regulating chondrogenesis and extracellular matrix turnover during temoporomandibular joint osteoarthritis pathology. PMID: 20035055
Biglycan deficiency significantly accelerated disc degeneration in mice. PMID: 19940720
Beta1 integrin and htis protein's binding sites are localized to different laminin-G-domain-like (LG) modules within the laminin alpha5 chain G domain. PMID: 12519075
decorin and biglycan play distinct roles in palatogenesis, and decorin was more actively involved in the process of secondary palate formation than biglycan. PMID: 12666199
biglycan deficient mice have diminished capacity to produce marrow stromal cells, the bone cell precursors, and this deficiency increases with age PMID: 12975603
Deficiency protects against increased trabecular bone turnover and bone loss in response to estrogen depletion. PMID: 14672350
bgn is required for retaining an appropriate microenvironment for the maturation of osteoblastic stem cells PMID: 15173106
In addition to the imbalance between differentiation and proliferation, there was a differential decrease in secretory leukocyte protease inhibitor (slpi) in bgn deficient osteoblasts treated with 1,25-(OH)(2)D(3) PMID: 16364709
biglycan is important for the maintenance of muscle cell integrity and plays a direct role in regulating the expression and sarcolemmal localization of the intracellular signaling proteins dystrobrevin-1 and -2, alpha- and beta1-syntrophin and nNOS PMID: 16807372
biglycan has a particularly important function during muscle and connective tissue development PMID: 16810681
Biglycan is a ligand for two members of the sarcoglycan complex and regulates their expression at discrete developmental ages. PMID: 16883602
Biglycan is a positive modulator of BMP-2 induced osteoblast differentiation PMID: 17120779
At embryonic day 18.5, alizarin red/alcian blue staining showed that the Bgn/Dcn double deficient mice had hypomineralization of the frontal and parietal craniofacial bones. PMID: 17188951
death of biglycan-deficient mice from aortic rupture implicates biglycan as essential for the structural and functional integrity of the aortic wall and implicates biglycan gene defects in the pathogenesis of aortic dissection and rupture PMID: 17502576
These preliminary data suggest that WISP-1 and BGN may functionally interact and control each other's activity, thus regulating the differentiation and proliferation of osteogenic cells. PMID: 18701807
Biglycan overexpression did not significantly affect the amelogenin expression in incisor and molar teeth in 3-day postnatal transgenic mice. PMID: 18727043
decorin has a primary role in regulating fibril assembly, a function that can be fine-tuned by biglycan during early development. PMID: 19136671
Findings indicate that normal expression of small leucine rich proteoglycans, such as biglycan and decorin, plays an important role in the highly orchestrated process of dentin mineralization. PMID: 19379665
By signaling through TLR2/4, biglycan stimulates the expression of NLRP3 and pro-IL-1beta mRNA. PMID: 19605353
Binds to the carboxyl-terminal third of the alpha-dystroglycan core polypeptide. This interaction requires the chondroitin sulfate side chains of biglycan. PMID: 10684260